polyclonal antibody against transferrins  (Agilent technologies)

Journal: Lung

Article Title: Soluble Transferrin Receptor-1 in Pulmonary Hypertension Associated with COPD

doi: 10.1007/s00408-025-00833-3

Figure Lengend Snippet: Tissue transferrin receptor-1 in LTX cohort. ( A ) Representative image of IHC staining for CD71 in the lung tissue of healthy donor. Scale: 50 µm. ( B ) Representative image of IHC staining for CD71 in the lung tissue of end-stage COPD patient with no/mild PH. Scale: 50 µm. ( C ) Representative image of IHC staining for CD71 in the lung tissue of end-stage COPD patient with moderate PH. Scale: 50 µm. ( D ) Representative image of IHC staining for CD71 in the lung tissue of end-stage COPD patient with severe PH. Scale: 50 µm. ( E ) Quantification of CD71-positive cells representing transferrin receptor-1 in lung tissues. ( F ) Correlation between the density of CD71-positive cells in the lung and mPAP in COPD. mPAP mean pulmonary artery pressure, V vessel

Article Snippet: Immunohistochemical (IHC) staining for transferrin receptor-1 (CD71) was conducted on formalin-fixed paraffin-embedded tissue sections using a polyclonal goat antibody against CD71 at 1:200 dilution (cat. #AF2474, RRID: AB_416601, R&D Systems, USA), followed by a biotinylated donkey anti-goat secondary IgG antibody (cat. #BA–9500–1.5, Vector Laboratories, USA) and an avidin–biotin complex HRP detection system from the ImmPACT NovaRED® Substrate Kit (cat. #SK-4805, Vector Laboratories, USA), as previously described [ ].

Techniques: Immunohistochemistry

Journal: International Journal of Molecular Sciences

Article Title: The Diffusion Model of Intra-Golgi Transport Has Limited Power

doi: 10.3390/ijms24021375

Figure Lengend Snippet: Reagents.

Article Snippet: Invitrogen rabbit polyclonal antibody against Transferrin Receptor , ThermoFisher Scientific, Milan, Italy , PA5-83022.

Techniques: Recombinant, Transfection, Modification, Plasmid Preparation

Journal: Mass Spectrometry

Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

doi: 10.5702/massspectrometry.A0084

Figure Lengend Snippet: Fig. 2. Sequences of the tryptic glycopeptide and the major glycoforms of transferrin.

Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

Techniques:

Journal: Mass Spectrometry

Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

doi: 10.5702/massspectrometry.A0084

Figure Lengend Snippet: Fig. 3. MALDI linear TOF mass spectrum of tryptic peptides of transferrin obtained from a healthy individual. The peaks indicated by sequence numbers in parentheses are ions without glycosylation sites. Their sequences are AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK (51–88) and AVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFK (149–193). Glycoforms at site-1 and site-2 are displayed in the lower and higher mass regions, respectively.

Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

Techniques: Sequencing

Journal: Mass Spectrometry

Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

doi: 10.5702/massspectrometry.A0084

Figure Lengend Snippet: Fig. 4. MALDI reflectron TOF mass spectra of tryptic peptides of transferrin. (a) CDG-I patient. Arrows indicate diagnostic ions. This patient is a compound heterozygote for ALG1 mutations and has a mutation in the SSR4 gene which is also among the candidate causes of CDG-I type abnormalities. (b) Healthy individual. Broken arrows indicate the positions of diagnostic ions; it is noteworthy that a small peak at m / z 2525.1 is observed in this unaffected subject.

Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

Techniques: Diagnostic Assay, Mutagenesis

Journal: Mass Spectrometry

Article Title: Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry to Detect Diagnostic Glycopeptide Markers of Congenital Disorders of Glycosylation

doi: 10.5702/massspectrometry.A0084

Figure Lengend Snippet: Fig. 5. MALDI linear TOF mass spectrum of tryptic peptides of transferrin from patients with various types of CDG-II.

Article Snippet: Briefly, an affinity column was prepared using a rabbit polyclonal antibody against human transferrin (DAKO, Denmark) and a ligand-coupling Sepharose column (HiTrap NHS-activated HP, GE Healthcare, Piscataway, NJ, USA), and the antibody-coupled Sepharose was recovered from the column.

Techniques: